Goevry Uk

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

logo

Header Banner

Goevry Uk

  • Travel & Lifestyle
    • Andsafe: Ihr zuverlässiger Partner für umfassenden Schutz und Seelenfrieden

      November 28, 2024
      0
    • Travel Insurance Explained: The Key to Safe, Protected, and Enjoyable Trips

      November 27, 2024
      0
    • Begeben Sie sich auf ein literarisches Abenteuer: Erschwingliche Romane aus zweiter Hand ...

      November 27, 2024
      0
    • Nolo: Simplifying Legal and Business Challenges with Practical Books

      November 27, 2024
      0
    • Entriegeln Sie Ihre Reise: Eine Welt des nahtlosen Reisens mit Premium-Autovermietung

      November 25, 2024
      0
    • GSF Car Parts: Driving Excellence with Premium Parts for Every Vehicle

      November 24, 2024
      0
    • Entdecke die Zukunft des Heimzugangs mit Nuki: Wo Intelligenz auf Sicherheit trifft

      November 1, 2024
      0
    • Ribble Cycles: Revolutionierung des Radsports durch Präzisionstechnik und Innovation

      October 25, 2024
      0
    • Discover the Vibrant Culture of New Orleans from Vue Orleans’ Heights

      October 15, 2024
      0
  • Fashion
    • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

      November 29, 2024
      0
    • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello ...

      November 29, 2024
      0
    • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

      November 29, 2024
      0
    • Unlock Incredible Savings: Up to 60% Off at Farah’s Black Friday Extravaganza!

      November 28, 2024
      0
    • Your Dream Wardrobe Awaits: Shop Club L London’s Black Friday Extravaganza

      November 28, 2024
      0
    • Heben Sie sich stilvoll ab mit der ultimativen T-Shirt-Kollektion von Impericon

      November 28, 2024
      0
    • Elevate Your Wardrobe with the Season’s Hottest Dress Trends

      November 28, 2024
      0
    • Unmissable Black Friday Deals: Up to 70% Off on Premium Footwear!

      November 28, 2024
      0
    • Upgrade Your Wardrobe with WAT THE BRAND’s Premium Knitwear Collection

      November 28, 2024
      0
  • Health & Beauty
    • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

      November 29, 2024
      0
    • Achieve Glowing Skin with Rodial's Premium Face Serums and Oils

      November 28, 2024
      0
    • Mühelose Gesundheit und Ernährung: Entdecken Sie die Bequemlichkeit von Ration1 und sparen ...

      November 28, 2024
      0
    • Eyes That Speak Volumes: Discover Sisley-Paris’s Luxurious Eye Make-Up Range

      November 28, 2024
      0
    • Fuel Your Fitness Goals for Less: Bulk™ Friday Sale Unveiled

      November 28, 2024
      0
    • Améliorez votre routine de soins de la peau avec les produits haut ...

      November 28, 2024
      0
    • Entfesseln Sie strahlende Haut: Die besten Produkte von Kiehl's für jeden Hauttyp ...

      November 28, 2024
      0
    • Transform Your Curls with Curlsmith: Embrace Natural Beauty with Confidence

      November 27, 2024
      0
    • A Pet Lover's Choice: TALES & TAILS für gesunde und glückliche Hunde

      November 25, 2024
      0
  • Science & Tech
    • Verwandeln Sie Ihre alte Elektronik in eine nachhaltige Lösung

      November 25, 2024
      0
    • GSF Car Parts Black Friday Bonanza: Major Discounts on Premium Car Parts

      November 23, 2024
      0
    • Verstärken Sie Ihre Reise mit den Hochleistungs-E-Scootern von Egret

      November 12, 2024
      0
    • EffectXMed par le Dr Margrit Lettko : Redéfinir les soins de la ...

      November 1, 2024
      0
    • Is the US military learning enough from Ukraine?

      September 29, 2024
      0
    • The Air Force wants to expand cloud-based comms, official says

      September 23, 2024
      0
    • What menaces November's elections? Threats of violence driven by misinformation, officials say

      September 16, 2024
      0
    • Could an easy radio fix have prevented the Trump assassination attempt?

      September 6, 2024
      0
    • ‘Moneyball’ for gun crews: Surprising data have Army division reshaping its gunnery ...

      September 1, 2024
      0
  • Gift Guides
    • Discover, Read, and Indulge: The MagazinesDirect Experience

      November 24, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Buying Guides
    • Big Adventures on Small Wheels: Discover KIDLY’s Scooters for Kids

      November 3, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

  • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello Molly

  • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

  • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

  • Die hochmodernen Geräte von Ninja Kitchen bringen den Koch in Ihnen zum Vorschein.

  • Die aufregende Welt der Jackpots: Wo jeder Dreh der Richtige sein könnte!

  • Achieve Glowing Skin with Rodial’s Premium Face Serums and Oils

Fashion
Home›Fashion›Guerlain Neroli Fragrance: Neroli Plein Sud is Here + More Beauty News

Guerlain Neroli Fragrance: Neroli Plein Sud is Here + More Beauty News

By admin1
February 2, 2024
255
0
Share:

[ad_1]

Photography Courtesy of Guerlain

Plus, M.A.C Cosmetics reformulates their iconic matte lipsticks.

By
Lauren Knowles

Date February 2, 2024

Guerlain unveils a new fragrance

guerlain neroli fragrance

“Picture kilometers of orange tree fields,” says perfumer Delphine Jelk over a video call. “The sky is blue, the sun is shining, and there’s a freshness in the air.” Jelk is describing the inspiration behind her latest creation, Guerlain’s Neroli Plein Sud. “One second, let me get something.” She reemerges on-screen with a travel diary from her time in Morocco. The notebook is filled with dried plants, sketches, and fabric swatches that inspired the luxe new fragrance. “I went to fashion design school before getting into perfumery, so I design fragrances exactly like I’d design clothes, starting with mood boards filled with colors, words, and pictures.

Néroli Plein Sud is born out of a collaboration with Antone de Saint Exupéry Youth Foundation, in honour of the beloved author of The Little Prince and Southern Mail (the latter which directly inspired the fragrance). To bring the latest addition to Guerlain’s L’Art & La Matière collection to life, Jelk combined neroli—an essential oil produced from the blossom of an orange tree–with turmeric, ginger, and cinnamon. At once crisp, spicy, and warm, she describes the scent as a “fresh breeze blowing over the hot sand of the Sahara [desert].”

Shop Now

Sulwhasoo’s S Line skincare collection has arrived


Fusing ancient knowledge with modern opulence, Sulwhasoo’s S Line is here to shake up the skincare space. Sought after for its youth-enhancing capabilities, the star Gingseng Berry SR ingredient (comprised of ginsenomics, a bioflavonoid and ginseng berry) is featured throughout the range.

Housed in a traditional Korean moon jar that doubles as a decorative statement piece, our favourite launch from the line is The Ultimate S Cream–which strengthens the skin’s moisture barrier and minimizes the appearance of fine lines and wrinkles.

Shop Now

M.A.C Cosmetics’ iconic matte lipsticks just got a makeover


This week, M.A.C Cosmetics upped the ante on its iconic OG matte lipsticks and revealed a reformulated version of their already beloved mattes, called the MACximal Silky Matte Lipsticks.

Adhering to a “maxed out to give lips more” mantra, these matte-meets-silk lipsticks boast more colour, comfort, and longevity than ever before. With over 30 shades—including cult classics like “Ruby Woo” and “Velvet Teddy—to play with, M.A.C is inspiring us to push our creativity to the max when it comes to makeup.

Shop Now

Olehenriksen adds three new shades to its Pout Preserve collection


Got a sweet tooth? Olehenriksen’s latest launch lets you wear your favourite dessert flavour on your lips. The Scandinavian skincare brand has just expanded its Pout Preserve Peptide Lip Treatment lineup to include shades Strawberry Sorbet, Cocoa Crème and limited-edition Blood Orange Spritz.

Featuring the same cloudberry seed oil, lip peptides, kokum butter and açai ingredients as the original Citrus Sunshine shade, this treatment will keep your pout looking smooth and juicy.

Shop Now

Tatcha drops a pore-purifying cleanser


If you’re already a fan of Tatcha cleansers like the Rice Wash and Camellia Cleansing Oil, allow us to introduce your new favourite: The Matcha Cleanse. This matcha-infused skincare staple leaves skin feeling squeaky clean but not stripped, reduces oil production, and primes the face for makeup application. The hero ingredient, Japanese Kyo-Matcha, is sourced straight from Uji, Japan–the best-known region in the country for matcha production. Talk about top of the line.

Shop Now

YSL Beauty launches a waterproof version of Lash Clash


YSL Beauty’s viral Lash Clash Volumizing Mascara just got an upgrade—and if you’re gearing up for a Spring break getaway anytime soon, you’re going to want to pack it in your toiletry bag. The just-dropped Lash Clash Extreme Volume Waterproof Mascara is water-, heat-, humidity-, and smudge-proof. Plus, it thickens and boosts your lashes to extreme volumes (by 400 perfect to be precise) for up to 48 hours. Not a want, but a need.

Shop Now

Bioré introduces an SPF-packed moisturizer


If you’ve used winter weather as an excuse to skip out on wearing sunscreen lately, consider this your reminder to wear SPF all year round. Fortunately for us, Bioré’s newly launched UV Aqua Rich Weightless Moisturizer SPF 50 UVA & UVB  will keep our skin protected from both the dryness of the winter and harsh UV rays that reflect off of surfaces like ice and snow when it’s still cold out.

Taking inspiration from Bioré Japan’s water-based sun protection products, this hyaluronic-acid-rich moisturizer instantly absorbs into thirsty skin without leaving a dreaded white cast behind. No matter the season, we’ll be reaching for this one.

Shop Now

This article contains affiliate links, so we may earn a small commission when you make a purchase through links on our site at no additional cost to you.

More Beauty & Grooming

Beauty & Grooming

By
Lauren Knowles

Date January 26, 2024

Beauty & Grooming

By
Lauren Knowles

Date January 19, 2024

Beauty & Grooming

By
Lauren Knowles

Date January 12, 2024

[ad_2]

Source link

Tagsartbeautybluedesignfashioninspirationjapanlifemakeupmemoodnewphotographyskyspringsweettravelvideoviralwinter
Previous Article

How to watch Butler vs. Creighton (2/2/24) ...

Next Article

Colour! Layering! Smiles! Copenhagen Fashion Week Street ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    How to realize sustainable fashion in the future

    August 26, 2022
    By admin1
  • Fashion

    BLACKPINK poisons corsets, Y2K fashion and other trends in new music video

    August 19, 2022
    By admin1
  • Health & Beauty

    Mindy Grayling on Mental Health and Mentorship – Minnesota Women’s Press

    September 25, 2022
    By admin1
  • Science & Tech

    Untangling the network effects of productivity and prominence among scientists

    August 20, 2022
    By admin1
  • All

    Mobile Mini UK invests in young local apprentices

    August 25, 2022
    By admin1
  • Fashion

    University of Alabama Celebrates Fashion Facility at Drummond Lyon Hall

    September 20, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Oldest African Dinosaur Discovered in Zimbabwe

  • Science & Tech

    Streamline Your Small Business with Xero’s Online Accounting Software

  • Science & Tech

    Mississippi Science Fest Returns to Jackson Sept. 15

Search

Categories

  • All (1,224)
  • Books & Novels (2)
  • Buying Guides (22)
  • Buying Guides (20)
  • Donation and Services (1)
  • Export Test (21)
  • Fashion (1,489)
  • Gift Guides (20)
  • Gift Guides (37)
  • Health & Beauty (1,384)
  • Health & Beauty (8)
  • Home&Living (55)
  • Mobility & Lifestyle (2)
  • Non classifié(e) (2)
  • Science & Tech (1,334)
  • Sports (12)
  • Technology (52)
  • Travel & Lifestyle (1)
  • Travel & Lifestyle (1,407)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

    By admin1
    November 29, 2024
  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

    By admin1
    November 29, 2024
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Call for designer diversity at Milan Fashion Week

    By admin1
    September 25, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy