Goevry Uk

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

logo

Header Banner

Goevry Uk

  • Travel & Lifestyle
    • Andsafe: Ihr zuverlässiger Partner für umfassenden Schutz und Seelenfrieden

      November 28, 2024
      0
    • Travel Insurance Explained: The Key to Safe, Protected, and Enjoyable Trips

      November 27, 2024
      0
    • Begeben Sie sich auf ein literarisches Abenteuer: Erschwingliche Romane aus zweiter Hand ...

      November 27, 2024
      0
    • Nolo: Simplifying Legal and Business Challenges with Practical Books

      November 27, 2024
      0
    • Entriegeln Sie Ihre Reise: Eine Welt des nahtlosen Reisens mit Premium-Autovermietung

      November 25, 2024
      0
    • GSF Car Parts: Driving Excellence with Premium Parts for Every Vehicle

      November 24, 2024
      0
    • Entdecke die Zukunft des Heimzugangs mit Nuki: Wo Intelligenz auf Sicherheit trifft

      November 1, 2024
      0
    • Ribble Cycles: Revolutionierung des Radsports durch Präzisionstechnik und Innovation

      October 25, 2024
      0
    • Discover the Vibrant Culture of New Orleans from Vue Orleans’ Heights

      October 15, 2024
      0
  • Fashion
    • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

      November 29, 2024
      0
    • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello ...

      November 29, 2024
      0
    • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

      November 29, 2024
      0
    • Unlock Incredible Savings: Up to 60% Off at Farah’s Black Friday Extravaganza!

      November 28, 2024
      0
    • Your Dream Wardrobe Awaits: Shop Club L London’s Black Friday Extravaganza

      November 28, 2024
      0
    • Heben Sie sich stilvoll ab mit der ultimativen T-Shirt-Kollektion von Impericon

      November 28, 2024
      0
    • Elevate Your Wardrobe with the Season’s Hottest Dress Trends

      November 28, 2024
      0
    • Unmissable Black Friday Deals: Up to 70% Off on Premium Footwear!

      November 28, 2024
      0
    • Upgrade Your Wardrobe with WAT THE BRAND’s Premium Knitwear Collection

      November 28, 2024
      0
  • Health & Beauty
    • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

      November 29, 2024
      0
    • Achieve Glowing Skin with Rodial's Premium Face Serums and Oils

      November 28, 2024
      0
    • Mühelose Gesundheit und Ernährung: Entdecken Sie die Bequemlichkeit von Ration1 und sparen ...

      November 28, 2024
      0
    • Eyes That Speak Volumes: Discover Sisley-Paris’s Luxurious Eye Make-Up Range

      November 28, 2024
      0
    • Fuel Your Fitness Goals for Less: Bulk™ Friday Sale Unveiled

      November 28, 2024
      0
    • Améliorez votre routine de soins de la peau avec les produits haut ...

      November 28, 2024
      0
    • Entfesseln Sie strahlende Haut: Die besten Produkte von Kiehl's für jeden Hauttyp ...

      November 28, 2024
      0
    • Transform Your Curls with Curlsmith: Embrace Natural Beauty with Confidence

      November 27, 2024
      0
    • A Pet Lover's Choice: TALES & TAILS für gesunde und glückliche Hunde

      November 25, 2024
      0
  • Science & Tech
    • Verwandeln Sie Ihre alte Elektronik in eine nachhaltige Lösung

      November 25, 2024
      0
    • GSF Car Parts Black Friday Bonanza: Major Discounts on Premium Car Parts

      November 23, 2024
      0
    • Verstärken Sie Ihre Reise mit den Hochleistungs-E-Scootern von Egret

      November 12, 2024
      0
    • EffectXMed par le Dr Margrit Lettko : Redéfinir les soins de la ...

      November 1, 2024
      0
    • Is the US military learning enough from Ukraine?

      September 29, 2024
      0
    • The Air Force wants to expand cloud-based comms, official says

      September 23, 2024
      0
    • What menaces November's elections? Threats of violence driven by misinformation, officials say

      September 16, 2024
      0
    • Could an easy radio fix have prevented the Trump assassination attempt?

      September 6, 2024
      0
    • ‘Moneyball’ for gun crews: Surprising data have Army division reshaping its gunnery ...

      September 1, 2024
      0
  • Gift Guides
    • Discover, Read, and Indulge: The MagazinesDirect Experience

      November 24, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Buying Guides
    • Big Adventures on Small Wheels: Discover KIDLY’s Scooters for Kids

      November 3, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

  • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello Molly

  • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

  • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

  • Die hochmodernen Geräte von Ninja Kitchen bringen den Koch in Ihnen zum Vorschein.

  • Die aufregende Welt der Jackpots: Wo jeder Dreh der Richtige sein könnte!

  • Achieve Glowing Skin with Rodial’s Premium Face Serums and Oils

Health & Beauty
Home›Health & Beauty›Manage your brain health and cognition easily with these simple tips – News

Manage your brain health and cognition easily with these simple tips – News

By admin1
September 15, 2022
283
0
Share:

[ad_1]

The ability to understand and acquire knowledge is protected by a healthy diet, regular exercise, vitamin D consumption, and participation in social activities.

Screenplay: Anne-Marie Stevens, Tereem Khan
Media Contact: Anna Jones

Sameera Davuluri2 60cbc56dbd865a753bfe961fa6639dc0Sameera Davuluri, MD,
Photo: Julie Nicole Miller
According to Alzheimer’s Disease International, dementia begins to affect 10 million people each year, and the number of people with dementia is only increasing. But there are ways to improve brain health and prevent at least some of the complications associated with aging, dementia, and similar conditions.

The Marnix E. Heersink School of Medicine at the University of Alabama at Birmingham wants to help patients learn more about the relationship between brain health and lifestyle. The effort is supported by the Department of Family and Community Health Clinics and the UAB Evelyn F. McKnight Brain Institute.

Sameera Davuluri, M.D., assistant professor and medical director of the Family Medicine Clinic at UAB Hoover Primary Care, offers advice on how to keep your brain healthy.

eat healthy

Diet is an important factor that influences overall health. According to Davuluri, certain foods that are good for your heart are good for your brain.

“There is no single food that is key to brain health, and there is no evidence that eating or avoiding one particular food can prevent cognitive decline,” Davuluri said. But patients need to focus on healthy food combinations throughout their lives to strengthen their minds and bodies.”

Following diets such as the Mediterranean diet, the Diet to Stop Hypertension (DASH), and a combination of the two called the MIND diet can help improve brain health. The MIND diet includes leafy greens and other vegetables, berries, whole grains, fish once a week, chicken twice a week, and beans, nuts, and olive oil as edible fats. Both the Mediterranean and MIND diets allow moderate amounts of wine.

Davuluri suggests watching your alcohol consumption and limiting pastries, processed foods, red meat, full-fat dairy, and salt. She also suggests eating fish, as it is the most powerful factor influencing higher cognitive function and slower decline.

“Diets high in monounsaturated and polyunsaturated fats are beneficial in improving brain health, reducing risk factors for stroke and heart disease,” says Davuluri. “There are no vitamins or supplements that have been shown to prevent cognitive decline. Certain conditions and vitamin deficiencies (B12 and folic acid) that can cause cognitive decline are reversible, so always check with your doctor. Consult: It’s never too late to start eating healthy and making small practical changes that are sustainable.”

For more specific recommendations regarding daily alcohol intake, consult your primary health care provider or visit the 2015-2022 Dietary Guidelines for Americans.

regular exercise

The Centers for Disease Control and Prevention says regular physical activity is an important part of a healthy lifestyle and is good for your brain as well as your muscles and bones.

According to Davuluri, several studies have linked aerobic exercise to cognitive improvements.

“Most adults should get 150 minutes of moderate-intensity exercise per week, which can be broken down in 30 minutes a day, five days a week,” says Davuluri. “This doesn’t have to happen all at once, it can only happen at the gym. Try incorporating activities into your daily routine, like walking the dog or moving your body while watching TV.”

be social

Getting involved in social activities and communities is good for your mental health as well as your brain health.

“Social activity reduces isolation, improves well-being, and improves cognition,” Davuluri said. Challenge yourself intellectually: get enough sleep, live a normal life, and focus on eating healthy.”

take a vitamin d supplement

Vitamin D is a fat-soluble vitamin that is naturally available in certain foods, fortified in other foods, or used as an over-the-counter supplement.

“Vitamin D is primarily responsible for promoting calcium balance in the body and helping to strengthen bones.”It also has other roles, such as reducing inflammation and regulating immune function. We don’t have enough information to find a correlation with brain health.”



[ad_2]

Source link

Tagsbodydailydaydietdogfamilyfoodgoodgymhealthhealthylifelifestylelikeslivelookphotoredsharewine
Previous Article

Beacon Media + Marketing Releases Guide on ...

Next Article

U.S. Secretary of Education promotes access to ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Best New Perfumes 2023: YSL MYSLF, Tom Ford Café Rose and More

    August 17, 2023
    By admin1
  • Travel & Lifestyle

    From Trout in Classroom Coordinator to Education Outreach Manager: Krista Hodges | Features

    August 14, 2022
    By admin1
  • Fashion

    The best street style beauty moments at Milan Fashion Week Spring-Summer 2023

    September 23, 2022
    By admin1
  • Fashion

    Harlem’s Fashion Row partners with LVMH to showcase three designers of color during NYFW

    August 17, 2022
    By admin1
  • Health & Beauty

    Kaiser Mental Health Workers Strike Hits One Month, Still No Deal – NBC Bay Area

    September 16, 2022
    By admin1
  • All

    New case study reveals traditional digital marketing strategies cost twice as much as they should

    September 21, 2022
    By admin1

You may interested

  • Science & Tech

    The Pentagon may never get to the bottom of that famous UFO video

  • Science & Tech

    Science center reveals names of World’s Fair dinosaurs at ‘Dinosaur Day’ event tomorrow

  • Science & Tech

    Glowing snails full of antifreeze protein found off the coast of Greenland

Search

Categories

  • All (1,224)
  • Books & Novels (2)
  • Buying Guides (20)
  • Buying Guides (22)
  • Donation and Services (1)
  • Export Test (21)
  • Fashion (1,489)
  • Gift Guides (20)
  • Gift Guides (37)
  • Health & Beauty (1,384)
  • Health & Beauty (8)
  • Home&Living (55)
  • Mobility & Lifestyle (2)
  • Non classifié(e) (2)
  • Science & Tech (1,334)
  • Sports (12)
  • Technology (52)
  • Travel & Lifestyle (1)
  • Travel & Lifestyle (1,407)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

    By admin1
    November 29, 2024
  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

    By admin1
    November 29, 2024
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Fall Leather Pieces to Round Off Your Fall Wardrobe

    By admin1
    September 1, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy