Goevry Uk

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

logo

Header Banner

Goevry Uk

  • Travel & Lifestyle
    • Andsafe: Ihr zuverlässiger Partner für umfassenden Schutz und Seelenfrieden

      November 28, 2024
      0
    • Travel Insurance Explained: The Key to Safe, Protected, and Enjoyable Trips

      November 27, 2024
      0
    • Begeben Sie sich auf ein literarisches Abenteuer: Erschwingliche Romane aus zweiter Hand ...

      November 27, 2024
      0
    • Nolo: Simplifying Legal and Business Challenges with Practical Books

      November 27, 2024
      0
    • Entriegeln Sie Ihre Reise: Eine Welt des nahtlosen Reisens mit Premium-Autovermietung

      November 25, 2024
      0
    • GSF Car Parts: Driving Excellence with Premium Parts for Every Vehicle

      November 24, 2024
      0
    • Entdecke die Zukunft des Heimzugangs mit Nuki: Wo Intelligenz auf Sicherheit trifft

      November 1, 2024
      0
    • Ribble Cycles: Revolutionierung des Radsports durch Präzisionstechnik und Innovation

      October 25, 2024
      0
    • Discover the Vibrant Culture of New Orleans from Vue Orleans’ Heights

      October 15, 2024
      0
  • Fashion
    • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

      November 29, 2024
      0
    • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello ...

      November 29, 2024
      0
    • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

      November 29, 2024
      0
    • Unlock Incredible Savings: Up to 60% Off at Farah’s Black Friday Extravaganza!

      November 28, 2024
      0
    • Your Dream Wardrobe Awaits: Shop Club L London’s Black Friday Extravaganza

      November 28, 2024
      0
    • Heben Sie sich stilvoll ab mit der ultimativen T-Shirt-Kollektion von Impericon

      November 28, 2024
      0
    • Elevate Your Wardrobe with the Season’s Hottest Dress Trends

      November 28, 2024
      0
    • Unmissable Black Friday Deals: Up to 70% Off on Premium Footwear!

      November 28, 2024
      0
    • Upgrade Your Wardrobe with WAT THE BRAND’s Premium Knitwear Collection

      November 28, 2024
      0
  • Health & Beauty
    • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

      November 29, 2024
      0
    • Achieve Glowing Skin with Rodial's Premium Face Serums and Oils

      November 28, 2024
      0
    • Mühelose Gesundheit und Ernährung: Entdecken Sie die Bequemlichkeit von Ration1 und sparen ...

      November 28, 2024
      0
    • Eyes That Speak Volumes: Discover Sisley-Paris’s Luxurious Eye Make-Up Range

      November 28, 2024
      0
    • Fuel Your Fitness Goals for Less: Bulk™ Friday Sale Unveiled

      November 28, 2024
      0
    • Améliorez votre routine de soins de la peau avec les produits haut ...

      November 28, 2024
      0
    • Entfesseln Sie strahlende Haut: Die besten Produkte von Kiehl's für jeden Hauttyp ...

      November 28, 2024
      0
    • Transform Your Curls with Curlsmith: Embrace Natural Beauty with Confidence

      November 27, 2024
      0
    • A Pet Lover's Choice: TALES & TAILS für gesunde und glückliche Hunde

      November 25, 2024
      0
  • Science & Tech
    • Verwandeln Sie Ihre alte Elektronik in eine nachhaltige Lösung

      November 25, 2024
      0
    • GSF Car Parts Black Friday Bonanza: Major Discounts on Premium Car Parts

      November 23, 2024
      0
    • Verstärken Sie Ihre Reise mit den Hochleistungs-E-Scootern von Egret

      November 12, 2024
      0
    • EffectXMed par le Dr Margrit Lettko : Redéfinir les soins de la ...

      November 1, 2024
      0
    • Is the US military learning enough from Ukraine?

      September 29, 2024
      0
    • The Air Force wants to expand cloud-based comms, official says

      September 23, 2024
      0
    • What menaces November's elections? Threats of violence driven by misinformation, officials say

      September 16, 2024
      0
    • Could an easy radio fix have prevented the Trump assassination attempt?

      September 6, 2024
      0
    • ‘Moneyball’ for gun crews: Surprising data have Army division reshaping its gunnery ...

      September 1, 2024
      0
  • Gift Guides
    • Discover, Read, and Indulge: The MagazinesDirect Experience

      November 24, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Buying Guides
    • Big Adventures on Small Wheels: Discover KIDLY’s Scooters for Kids

      November 3, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

  • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello Molly

  • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

  • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

  • Die hochmodernen Geräte von Ninja Kitchen bringen den Koch in Ihnen zum Vorschein.

  • Die aufregende Welt der Jackpots: Wo jeder Dreh der Richtige sein könnte!

  • Achieve Glowing Skin with Rodial’s Premium Face Serums and Oils

All
Home›All›NEPC trains Southeast Asian non-oil exporters in digital marketing

NEPC trains Southeast Asian non-oil exporters in digital marketing

By admin1
September 9, 2022
240
0
Share:

[ad_1]

1 of Nigeria Export Promotion Council (NEPC) says it has trained at least 50 non-oil exporters in the Southeast on digital marketing.

Nigerian newspapers read them online

2 Mrs. Salamatu Audi The Council’s Policy and Strategy Division said this during the Zone’s e-commerce training on Friday Enugu.

Nigerian newspapers read them online

3 Audi said the training is to help exporters effectively use the council’s e-commerce platform.

Nigerian newspapers read them online

Four She said the training was organized in collaboration with NEPC National Information Technology Development Agency (NITDA).

Five She said high volatility and a declining economy have made it expedient for exporters to boost their business through digital marketing.

6 According to Audi, digital marketing gives people the opportunity to access free online portals.

7 It also helps provide a platform for exporters to have a ‘domain name’ to sell their products.

8 “In the past, our exporters have not been able to put much effort into marketing their products due to distance and costs.

9 “To break down business barriers, you need to be tech savvy and have an online shop.

Ten ”
Audi said that under the digital age, physical stores are no longer enough to participate in the global market.

11 “So we are working together Nitta It’s for training small business operators,” she said.

12 She said the participants “are already reasonably building their capabilities in the global marketplace.”

13 She said she was given a free personal domain name where she would sell her products for a year.

14 Also, the Council’s Southeast Regional Coordinator, Mr. Arnold Jacksonsaid the training is to help participants showcase their products in the global market.

15 Jackson said e-commerce will revolutionize global trade and people won’t have to physically move before selling a product.

16 “We would like to open up our e-commerce platform to ensure that exporters in the zone can sell their products over the internet.

17 “In the current reality of the country, it is best to go digital, but certain parameters need to be set to be able to sell on that platform,” said Jackson.

18 Also, an employee of NEPC, Mr. Tony Orenroasaid non-oil exports had become the only viable means of survival for the country.

19 Olenloa said that as part of its services, NEPC has helped exporters compete globally.

20 NITDA representative Mr. Oguntade Adesaisays digital marketing has helped businesses create value for their customers and build strong customer relationships.

News source credit: naan

www bet9ja shop

[ad_2]

Source link

TagsbestbuildingBusinessfreefridaymarketingnewspeopleshopstrongTechthetrainingyou
Previous Article

ENTREPRENEUR UNIVERSE BRIGHT GROUP ANNOUNCES CHANGE OF ...

Next Article

TikTok unveils new programming and creative effects ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Second-hand fashion can be done without a person giving a virtue signal

    September 4, 2022
    By admin1
  • Health & Beauty

    “Abortion is Absolutely Health Care,” US House Panel Says as Republicans Pursue Nationwide Ban

    September 30, 2022
    By admin1
  • All

    Why Relevance Matters

    September 28, 2022
    By admin1
  • Health & Beauty

    See homes sold in the Brick area, Feb. 5 to Feb. 11

    February 14, 2024
    By admin1
  • Science & Tech

    Meat science director talks about the next generation of local producers

    September 2, 2022
    By admin1
  • All

    America, Intel, and the CHIPS Act

    July 27, 2022
    By admin1

You may interested

  • Science & Tech

    Marbury High School Opens Agricultural Addition

  • Science & Tech

    How Successful Startup Founders Win Over Investors, According to Science

  • Science & Tech

    Techniques learned from Earth climate science help search for potentially habitable exoplanets

Search

Categories

  • All (1,224)
  • Books & Novels (2)
  • Buying Guides (22)
  • Buying Guides (20)
  • Donation and Services (1)
  • Export Test (21)
  • Fashion (1,489)
  • Gift Guides (37)
  • Gift Guides (20)
  • Health & Beauty (1,384)
  • Health & Beauty (8)
  • Home&Living (55)
  • Mobility & Lifestyle (2)
  • Non classifié(e) (2)
  • Science & Tech (1,334)
  • Sports (12)
  • Technology (52)
  • Travel & Lifestyle (1)
  • Travel & Lifestyle (1,407)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

    By admin1
    November 29, 2024
  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

    By admin1
    November 29, 2024
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Furniture in Fashion: Your One-Stop Shop for Stylish, Affordable Furniture

    By admin1
    October 30, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy