Goevry Uk

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

logo

Header Banner

Goevry Uk

  • Travel & Lifestyle
    • Andsafe: Ihr zuverlässiger Partner für umfassenden Schutz und Seelenfrieden

      November 28, 2024
      0
    • Travel Insurance Explained: The Key to Safe, Protected, and Enjoyable Trips

      November 27, 2024
      0
    • Begeben Sie sich auf ein literarisches Abenteuer: Erschwingliche Romane aus zweiter Hand ...

      November 27, 2024
      0
    • Nolo: Simplifying Legal and Business Challenges with Practical Books

      November 27, 2024
      0
    • Entriegeln Sie Ihre Reise: Eine Welt des nahtlosen Reisens mit Premium-Autovermietung

      November 25, 2024
      0
    • GSF Car Parts: Driving Excellence with Premium Parts for Every Vehicle

      November 24, 2024
      0
    • Entdecke die Zukunft des Heimzugangs mit Nuki: Wo Intelligenz auf Sicherheit trifft

      November 1, 2024
      0
    • Ribble Cycles: Revolutionierung des Radsports durch Präzisionstechnik und Innovation

      October 25, 2024
      0
    • Discover the Vibrant Culture of New Orleans from Vue Orleans’ Heights

      October 15, 2024
      0
  • Fashion
    • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

      November 29, 2024
      0
    • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello ...

      November 29, 2024
      0
    • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

      November 29, 2024
      0
    • Unlock Incredible Savings: Up to 60% Off at Farah’s Black Friday Extravaganza!

      November 28, 2024
      0
    • Your Dream Wardrobe Awaits: Shop Club L London’s Black Friday Extravaganza

      November 28, 2024
      0
    • Heben Sie sich stilvoll ab mit der ultimativen T-Shirt-Kollektion von Impericon

      November 28, 2024
      0
    • Elevate Your Wardrobe with the Season’s Hottest Dress Trends

      November 28, 2024
      0
    • Unmissable Black Friday Deals: Up to 70% Off on Premium Footwear!

      November 28, 2024
      0
    • Upgrade Your Wardrobe with WAT THE BRAND’s Premium Knitwear Collection

      November 28, 2024
      0
  • Health & Beauty
    • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

      November 29, 2024
      0
    • Achieve Glowing Skin with Rodial's Premium Face Serums and Oils

      November 28, 2024
      0
    • Mühelose Gesundheit und Ernährung: Entdecken Sie die Bequemlichkeit von Ration1 und sparen ...

      November 28, 2024
      0
    • Eyes That Speak Volumes: Discover Sisley-Paris’s Luxurious Eye Make-Up Range

      November 28, 2024
      0
    • Fuel Your Fitness Goals for Less: Bulk™ Friday Sale Unveiled

      November 28, 2024
      0
    • Améliorez votre routine de soins de la peau avec les produits haut ...

      November 28, 2024
      0
    • Entfesseln Sie strahlende Haut: Die besten Produkte von Kiehl's für jeden Hauttyp ...

      November 28, 2024
      0
    • Transform Your Curls with Curlsmith: Embrace Natural Beauty with Confidence

      November 27, 2024
      0
    • A Pet Lover's Choice: TALES & TAILS für gesunde und glückliche Hunde

      November 25, 2024
      0
  • Science & Tech
    • Verwandeln Sie Ihre alte Elektronik in eine nachhaltige Lösung

      November 25, 2024
      0
    • GSF Car Parts Black Friday Bonanza: Major Discounts on Premium Car Parts

      November 23, 2024
      0
    • Verstärken Sie Ihre Reise mit den Hochleistungs-E-Scootern von Egret

      November 12, 2024
      0
    • EffectXMed par le Dr Margrit Lettko : Redéfinir les soins de la ...

      November 1, 2024
      0
    • Is the US military learning enough from Ukraine?

      September 29, 2024
      0
    • The Air Force wants to expand cloud-based comms, official says

      September 23, 2024
      0
    • What menaces November's elections? Threats of violence driven by misinformation, officials say

      September 16, 2024
      0
    • Could an easy radio fix have prevented the Trump assassination attempt?

      September 6, 2024
      0
    • ‘Moneyball’ for gun crews: Surprising data have Army division reshaping its gunnery ...

      September 1, 2024
      0
  • Gift Guides
    • Discover, Read, and Indulge: The MagazinesDirect Experience

      November 24, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Buying Guides
    • Big Adventures on Small Wheels: Discover KIDLY’s Scooters for Kids

      November 3, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

  • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello Molly

  • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

  • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

  • Die hochmodernen Geräte von Ninja Kitchen bringen den Koch in Ihnen zum Vorschein.

  • Die aufregende Welt der Jackpots: Wo jeder Dreh der Richtige sein könnte!

  • Achieve Glowing Skin with Rodial’s Premium Face Serums and Oils

Science & Tech
Home›Science & Tech›Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

Aaron Rodgers tinkers with the science of psychedelics. Drugs like ayahuasca can change the brain, but how?

By admin1
September 29, 2022
280
0
Share:

[ad_1]

Green Bay Packers quarterback Aaron Rodgers has been vocal about the positive benefits he’s experienced from using the Amazon hallucinogen ayahuasca. It has been suggested that it has rapid antidepressant properties that may help treat addiction.

However, Rogers maintains that ayahuasca is not a drug.

“It has hallucinogenic properties. [sic] ability,” Rogers said during a recent appearancePat McAfee Shaw,” explains the exact behavior of the drug. “But it’s not a drug. We’re talking about plants here.”

This isn’t the first time Rodgers has messed with science on the topic of health. It contains drugs such as (N,N-dimethyltryptamine) and harmine. Otherwise no one will drink it. That’s like saying that decaf coffee makes a good back-up player for espresso.

Psychedelics like ayahuasca are becoming increasingly popular — and not just among people like Rogers who can afford to travel to Peru. Interest in ‘magic’ mushrooms is exploding. It captivated Western viewers who were plagued by fatigue.

Based on the vast amount of psychedelic research, that seems to be the case. But how exactly is this achieved? What is your reason for changing your life?

A new paper in the journal Neuropsychopharmacology summarizes what we know and don’t know about the effects of hallucinogens on the brain. Peeking under the hood, two scientists at the Center for Psychiatric Research at the University of Friborg in Switzerland examined the available evidence to determine the doses needed, where in the brain these changes occur. or how long they last, and any of these changes. In fact, it has real therapeutic value.

Scientists believed that brain development almost stopped after a certain age. We now know that’s not true.

Much of this psychedelic research relies on a concept called neuroplasticity, or, as one article put it, the brain’s ability to “correct, change and adapt.” Scientists believed that brain development almost stopped after a certain age. We now know that’s not true. Drugs and other methods can induce changes in the brain at any age.

But experts still don’t fully understand how this happens on a neurological level. It is essential for developing tools (i.e. medicines) to maintain good health.

However, much of the research into psychedelic neuroplasticity has been done in animals rather than humans. Measuring changes in the living human brain is not easy, but by giving rats and mice psychedelic drugs and measuring the size of neurons before and after administration, we can see what is happening and what is happening. You can learn a lot about what is not.

One of the most important aspects of psychedelics is the shape of the molecule. Looking at the chemical structures of drugs such as LSD, psilocybin, DMT, and 5-MeO-DMT (also known as “toad poison”), they are all highly toxic to serotonin, a chemical widely used in the body. looks similar. Especially the biological processes that keep the brain online. As a result, serotonin has been linked to many psychiatric and neurological conditions such as schizophrenia and autism.


Want more health and science articles in your inbox? Subscribe to Salon’s weekly newsletter, The Vulgar Scientist.


Psychedelics are like keys in roughly the same shape (but not exactly) as serotonin. Close enough for these drugs to slip into “locks” or receptors within cells and exert downstream effects on genes that strengthen the growth of new brain cells and the connections between existing neurons.

Most brain changes appear to be related to brain-derived neurotrophic factor (BDNF). BDNF is a protein our body naturally produces to regulate our nervous system. Not only does it play an important role in memory, but it also appears to promote biological processes related to neuron growth.Psychedelics appear to increase levels of BDNF. In fact, introducing psilocybin into the mouse brain allows us to see this growth in near real time.

Our brains are filled with billions of neurons, each with long, dangling threads called dendrites. BDNF is like fertilizer for neurons, growing large, bushy dendrites and creating more connections in the brain. Healthy neuronal forests are associated with positive mental health, while conditions such as PTSD and depression are associated with low levels of BDNF.

Several lines of evidence suggest that hallucinogens can create feedback loops between different receptors and generate large amounts of BDNF. This effect can last for several days in what Swiss researchers call the “window of plasticity,” and can help humans become more responsive to treatments or recover from injuries such as stroke. Moreover, the effects seem to be long-lasting, lasting up to a month in some people.

However, “long-term experiences of anxiety and distress in a state of heightened plasticity can be detrimental,” warn the authors. In some cases, it can rewire the brain in unpleasant ways. This is a condition in which some of the effects of psychedelic drugs, such as hallucinations and psychological distress, persist long after the drug wears off.

“Neuroplasticity may play a role not only in the long-term positive effects of psychedelics, but also in their undesirable effects,” the authors warn. Thankfully, these side effects are relatively rare and can be managed by taking the medication in a safe environment or with a therapist or guide.

There’s still a lot we don’t know about the brain, not to mention when powerful hallucinogens are added to the mix.

These are some of the leading theories about how psychedelics alter the brain, but they are still theoretical. For example, DMT (the main ingredient in ayahuasca) may involve receptors other than serotonin, such as the sigma-1 receptor.

Certainly stronger evidence is needed, such as using human subjects. The more we investigate the effects of drugs on the brain, the more it becomes clear how this wonderful metabolic machine works uniquely.

You shouldn’t expect a football player like Rodgers to score touchdowns in a subject as complex as neuroscience. The proof is in pudding, and Rogers’ experience with drugs is valid. Only he can say whether his ayahuasca journey was positive or life-affirming, but we can argue for the correct term: “drugs” is not a dirty word. Hallucinogens are drugs, and these substances can tell us a lot about ourselves.

read more

About psychedelics and the body



[ad_2]

Source link

Tagsanimalsbodycoffeedrinkfootballgoodgreenhealthhealthylifemagicnewpeopleplantsswitzerlandthetimetravelyouyoutube
Previous Article

Social media reacts to Cincinnati Bengals QB’s ...

Next Article

Press Releases | Press | Chair’s Newsroom ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Former Mott Branch Library Rezoned into Compassionate Health Toledo Clinic

    September 14, 2022
    By admin1
  • Health & Beauty

    Health Fair for Medicaid Clients Set for Tuesday | Local News

    August 14, 2022
    By admin1
  • Health & Beauty

    Cortez Masto announces funding for more mental health professionals in Nevada schools

    January 26, 2023
    By admin1
  • All

    India Digital Marketing Market Size, Share, Trends, Growth and Forecast Analysis 2021-2026

    August 17, 2022
    By admin1
  • Fashion

    Fashion is back with a novel treatment of colors and textiles

    September 16, 2022
    By admin1
  • Fashion

    Discover Affordable Elegance: The Best Jewelry Finds on Ali Express

    November 1, 2023
    By admin1

You may interested

  • Science & Tech

    Science education! why? | | News

  • Science & Tech

    Pentagon CIO prepares to take over 5G network portfolio

  • Science & Tech

    Kids learning about STEM at Mississippi Science Fest

Search

Categories

  • All (1,224)
  • Books & Novels (2)
  • Buying Guides (20)
  • Buying Guides (22)
  • Donation and Services (1)
  • Export Test (21)
  • Fashion (1,489)
  • Gift Guides (20)
  • Gift Guides (37)
  • Health & Beauty (1,384)
  • Health & Beauty (8)
  • Home&Living (55)
  • Mobility & Lifestyle (2)
  • Non classifié(e) (2)
  • Science & Tech (1,334)
  • Sports (12)
  • Technology (52)
  • Travel & Lifestyle (1,407)
  • Travel & Lifestyle (1)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

    By admin1
    November 29, 2024
  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

    By admin1
    November 29, 2024
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • DC monkeypox cases declining, but public health experts urge caution

    By admin1
    September 3, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy