Goevry Uk

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • US
  • DE

logo

Header Banner

Goevry Uk

  • Travel & Lifestyle
    • Andsafe: Ihr zuverlässiger Partner für umfassenden Schutz und Seelenfrieden

      November 28, 2024
      0
    • Travel Insurance Explained: The Key to Safe, Protected, and Enjoyable Trips

      November 27, 2024
      0
    • Begeben Sie sich auf ein literarisches Abenteuer: Erschwingliche Romane aus zweiter Hand ...

      November 27, 2024
      0
    • Nolo: Simplifying Legal and Business Challenges with Practical Books

      November 27, 2024
      0
    • Entriegeln Sie Ihre Reise: Eine Welt des nahtlosen Reisens mit Premium-Autovermietung

      November 25, 2024
      0
    • GSF Car Parts: Driving Excellence with Premium Parts for Every Vehicle

      November 24, 2024
      0
    • Entdecke die Zukunft des Heimzugangs mit Nuki: Wo Intelligenz auf Sicherheit trifft

      November 1, 2024
      0
    • Ribble Cycles: Revolutionierung des Radsports durch Präzisionstechnik und Innovation

      October 25, 2024
      0
    • Discover the Vibrant Culture of New Orleans from Vue Orleans’ Heights

      October 15, 2024
      0
  • Fashion
    • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

      November 29, 2024
      0
    • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello ...

      November 29, 2024
      0
    • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

      November 29, 2024
      0
    • Unlock Incredible Savings: Up to 60% Off at Farah’s Black Friday Extravaganza!

      November 28, 2024
      0
    • Your Dream Wardrobe Awaits: Shop Club L London’s Black Friday Extravaganza

      November 28, 2024
      0
    • Heben Sie sich stilvoll ab mit der ultimativen T-Shirt-Kollektion von Impericon

      November 28, 2024
      0
    • Elevate Your Wardrobe with the Season’s Hottest Dress Trends

      November 28, 2024
      0
    • Unmissable Black Friday Deals: Up to 70% Off on Premium Footwear!

      November 28, 2024
      0
    • Upgrade Your Wardrobe with WAT THE BRAND’s Premium Knitwear Collection

      November 28, 2024
      0
  • Health & Beauty
    • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

      November 29, 2024
      0
    • Achieve Glowing Skin with Rodial's Premium Face Serums and Oils

      November 28, 2024
      0
    • Mühelose Gesundheit und Ernährung: Entdecken Sie die Bequemlichkeit von Ration1 und sparen ...

      November 28, 2024
      0
    • Eyes That Speak Volumes: Discover Sisley-Paris’s Luxurious Eye Make-Up Range

      November 28, 2024
      0
    • Fuel Your Fitness Goals for Less: Bulk™ Friday Sale Unveiled

      November 28, 2024
      0
    • Améliorez votre routine de soins de la peau avec les produits haut ...

      November 28, 2024
      0
    • Entfesseln Sie strahlende Haut: Die besten Produkte von Kiehl's für jeden Hauttyp ...

      November 28, 2024
      0
    • Transform Your Curls with Curlsmith: Embrace Natural Beauty with Confidence

      November 27, 2024
      0
    • A Pet Lover's Choice: TALES & TAILS für gesunde und glückliche Hunde

      November 25, 2024
      0
  • Science & Tech
    • Verwandeln Sie Ihre alte Elektronik in eine nachhaltige Lösung

      November 25, 2024
      0
    • GSF Car Parts Black Friday Bonanza: Major Discounts on Premium Car Parts

      November 23, 2024
      0
    • Verstärken Sie Ihre Reise mit den Hochleistungs-E-Scootern von Egret

      November 12, 2024
      0
    • EffectXMed par le Dr Margrit Lettko : Redéfinir les soins de la ...

      November 1, 2024
      0
    • Is the US military learning enough from Ukraine?

      September 29, 2024
      0
    • The Air Force wants to expand cloud-based comms, official says

      September 23, 2024
      0
    • What menaces November's elections? Threats of violence driven by misinformation, officials say

      September 16, 2024
      0
    • Could an easy radio fix have prevented the Trump assassination attempt?

      September 6, 2024
      0
    • ‘Moneyball’ for gun crews: Surprising data have Army division reshaping its gunnery ...

      September 1, 2024
      0
  • Gift Guides
    • Discover, Read, and Indulge: The MagazinesDirect Experience

      November 24, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Buying Guides
    • Big Adventures on Small Wheels: Discover KIDLY’s Scooters for Kids

      November 3, 2024
      0
    • Stand with the Champions: Discover AC Milan's Newest Gear

      September 30, 2024
      0
    • Feel Confident, Look Beautiful: Chi Chi Clothing’s Fashion for Every Occasion

      September 29, 2024
      0
    • Bold, Chic, and Unapologetic: Public Desire’s Fashion for Every Occasion

      September 28, 2024
      0
    • Gigi Hadid is shipping fashion to new heights as she sports mini ...

      September 27, 2024
      0
    • Maya Jama puts on a busty display in a plunging white top ...

      September 23, 2024
      0
    • Kylie Minogue fans issue same desperate plea as she announces new Tension ...

      September 19, 2024
      0
    • Embrace the Legacy: Join the AC Milan Family Today!

      September 19, 2024
      0
    • Eco-Friendly Style: Discover Alohas Vests Today!

      September 17, 2024
      0
  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

  • Black Friday Sale Alert: Up to 80% OFF on Fashion at Hello Molly

  • Black Friday Fashion Frenzy: Unbeatable Deals on Dresses at Meshki

  • Transform Your Beauty Routine with Rodial’s Innovative Makeup Line

  • Die hochmodernen Geräte von Ninja Kitchen bringen den Koch in Ihnen zum Vorschein.

  • Die aufregende Welt der Jackpots: Wo jeder Dreh der Richtige sein könnte!

  • Achieve Glowing Skin with Rodial’s Premium Face Serums and Oils

All
Home›All›Arjun Gupta: Youngest serial entrepreneur with impeccable business skills

Arjun Gupta: Youngest serial entrepreneur with impeccable business skills

By admin1
August 20, 2022
261
0
Share:

[ad_1]

India’s business, entrepreneurship and industry-related spheres are digitally evolving and continue to advance using the latest internet technologies and artificial intelligence. Arjun Gupta is a young entrepreneur working in his field of digital marketing and advertising. He is the founder of AN Group International, a digital marketing and brand his solutions company. Arjun Gupta is known for having clients of international and national celebrities, brands and artists who rely on him to grow digitally and expand their brands in the online space.what connected Arjun Gupta How to become the youngest serial entrepreneur in India? read.

Ever since Arjun was in school, curiosity and inquisitiveness have been one of his dominant traits. He was drawn to the Internet and the way new businesses took advantage of it to grow exponentially. After several freelance projects, Arjun Gupta found out what he wanted to do in life: become an expert in his digital marketing.

He founded his own company known as AN Group International and started working on online projects, digital marketing assignments and social media management. About his early days in the digital marketing field, Arjun Gupta said: It will be the foundation for all future efforts. I had to work long hours to acquire my skill set and reach the standards I set for myself. ”

AN Group International, Arjun Gupta’s company of excellence, specializes in IT-based solutions, social media handling, e-commerce development, digital marketing, online advertising, press publication (PR), search engine optimization, websites and applications. We provide all kinds of digital services, such as the development of

As of today, Arjun’s company has surpassed one million in terms of sales and revenue. Thanks to his great knowledge and expertise in the digital realm, Arjun works with high-end clients and big spending brands internationally and domestically. A factor in Arjun Gupta’s achievements in the country’s digital and entrepreneurial sector is the quality and efficiency of the work he delivers. The results he produces are a testament to the fact that he never returns to his commitments.

The youngest serial entrepreneur, Arjun Gupta, is a promising name in the country’s digital marketing domain. He excels in the online space and has some very valuable possessions. The client is satisfied and would like to collaborate with him again.

like this:

favorite Now loading…

Related



[ad_2]

Source link

TagsbrandBusinessentrepreneurfacebookindialifemarketingmymyselfnewschoolthetodaywork
Previous Article

How are Pakistani supermodels and bloggers influencing ...

Next Article

EHRs don’t reduce costs for rural hospitals

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    British fashion publications go dark for Queen Elizabeth II’s funeral – WWD

    September 19, 2022
    By admin1
  • Science & Tech

    Scientists are racing to digitize the DNA of every known species on Earth

    August 27, 2022
    By admin1
  • Fashion

    London prepares for four days of fashion shows and Queen’s funeral – WWD

    September 16, 2022
    By admin1
  • Fashion

    London Fashion Week SS23 Day 3 Highlights

    September 19, 2022
    By admin1
  • Science & Tech

    Lab-Aids Reveals Global Plan to Transform Science Education

    September 14, 2022
    By admin1
  • Science & Tech

    The crossroads facing Indian science has changed in the last 75 years – The Wire Science

    August 15, 2022
    By admin1

You may interested

  • Science & Tech

    What Science Says About Diet for Cholesterol

  • Science & Tech

    Councilor Claire Sillett recalls efforts to insult climate science

  • Science & Tech

    What are data scientists’ biggest concerns? The 2022 State of Data Science report has the answers

Search

Categories

  • All (1,224)
  • Books & Novels (2)
  • Buying Guides (22)
  • Buying Guides (20)
  • Donation and Services (1)
  • Export Test (21)
  • Fashion (1,489)
  • Gift Guides (37)
  • Gift Guides (20)
  • Health & Beauty (1,384)
  • Health & Beauty (8)
  • Home&Living (55)
  • Mobility & Lifestyle (2)
  • Non classifié(e) (2)
  • Science & Tech (1,334)
  • Sports (12)
  • Technology (52)
  • Travel & Lifestyle (1)
  • Travel & Lifestyle (1,407)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Meshki Cotton Dresses: The Ultimate in Comfort and Fashion

    By admin1
    November 29, 2024
  • FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

    By admin1
    November 29, 2024
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Amid turmoil, Vt. Education officials say masks may be required in certain school situations

    By admin1
    September 14, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy